IL-33, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IL-33, Human
Description :
IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.Product Name Alternative :
IL-33 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/il-33-protein-human.htmlPurity :
97.00Smiles :
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSETMolecular Formula :
90865 (Gene_ID) O95760-1 (S112-T270) (Accession)Molecular Weight :
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Matsuda A, et al. The role of interleukin-33 in chronic allergic conjunctivitis. Invest Ophthalmol Vis Sci. 2009 Oct;50 (10) :4646-52.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

