Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG) -VLPs, Fluorescent
CAT:
399-CSB-MP619083HU(A4)-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
-WB.jpg)

-WB.jpg&w=128&q=75)

Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG) -VLPs, Fluorescent
- CAS Number: 9000-83-3
- Gene Name: MOG
- UniProt: Q16653
- Expression Region: 30-247aa
- Organism: Homo sapiens
- Target Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
- Tag: C-terminal EGFP-tagged
- Source: Mammalian cell
- Field of Research: Signal Transduction
- Assay Type: MP-VLP Transmembrane Protein & Developed Protein
- Relevance: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. ; (Microbial infection) Acts as a receptor for rubella virus.
- Purity: The purity information is not available for VLPs proteins.
- Activity: Not Test
- Length: Full Length of Mature Protein
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
- Molecular Weight: 55.9 kDa
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.