Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG) -VLPs, Fluorescent

Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG) -VLPs, Fluorescent

• CAS Number: 9000-83-3
• Gene Name: MOG
• UniProt: Q16653
• Expression Region: 30-247aa
• Organism: Homo sapiens
• Target Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
• Tag: C-terminal EGFP-tagged
• Source: Mammalian cell
• Field of Research: Signal Transduction
• Assay Type: MP-VLP Transmembrane Protein & Developed Protein
• Relevance: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. ; (Microbial infection) Acts as a receptor for rubella virus.
• Purity: The purity information is not available for VLPs proteins.
• Activity: Not Test
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.
• Molecular Weight: 55.9 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.