Recombinant Phaseolus vulgaris Leghemoglobin A | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1002641-01	Recombinant Phaseolus vulgaris Leghemoglobin
MBS1005770-02	Recombinant Phaseolus vulgaris Endochitinase
MBS1005770-05	Recombinant Phaseolus vulgaris Endochitinase
MBS1132662-03	Recombinant Phaseolus vulgaris Endoglucanase
MBS1132662-02	Recombinant Phaseolus vulgaris Endoglucanase
MBS1132662-04	Recombinant Phaseolus vulgaris Endoglucanase
MBS1002641-02	Recombinant Phaseolus vulgaris Leghemoglobin
MBS1002641-03	Recombinant Phaseolus vulgaris Leghemoglobin
MBS1002641-04	Recombinant Phaseolus vulgaris Leghemoglobin
MBS1005770-04	Recombinant Phaseolus vulgaris Endochitinase

Recombinant Phaseolus vulgaris Leghemoglobin A

CAT:

399-CSB-EP355811EUN-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Phaseolus vulgaris Leghemoglobin A

UniProt: P02234
Expression Region: 2-146aa
Organism: Phaseolus vulgaris (Kidney bean) (French bean)
Target Sequence: GAFTEKQEALVNSSWEAFKGNIPQYSVVFYTSILEKAPAAKNLFSFLANGVDPTNPKLTAHAESLFGLVRDSAAQLRANGAVVADAALGSIHSQKGVSNDQFLVVKEALLKTLKQAVGDKWTDQLSTALELAYDELAAAIKKAYA
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source: E.coli
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Provides oxygen to the bacteroids. This role is essential for symbiotic nitrogen fixation.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 22.9 kDa
References & Citations: "The amino-acid sequence of leghemoglobin component A from Phaseolus vulgaris (kidney bean)." Lehtovaara P., Ellfolk N. Eur. J. Biochem. 54:577-584 (1975)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Phaseolus vulgaris Leghemoglobin A, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP355811EUN-03	Recombinant Phaseolus vulgaris Leghemoglobin A
CSB-EP355811EUN-02	Recombinant Phaseolus vulgaris Leghemoglobin A
CSB-EP355811EUN-01	Recombinant Phaseolus vulgaris Leghemoglobin A
CSB-EP343003VETb1-02	Recombinant Vespula vulgaris Phospholipase A1
CSB-YP343003VET-03	Recombinant Vespula vulgaris Phospholipase A1
CSB-EP343003VETc7-03	Recombinant Vespula vulgaris Phospholipase A1
CSB-EP343003VETc7-01	Recombinant Vespula vulgaris Phospholipase A1
CSB-EP343003VETb1-01	Recombinant Vespula vulgaris Phospholipase A1
CSB-YP343003VET-02	Recombinant Vespula vulgaris Phospholipase A1
CSB-YP343003VET-01	Recombinant Vespula vulgaris Phospholipase A1

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on