Rab5 Protein

CAT:
400-SPR-121B
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Rab5 Protein - image 1

Rab5 Protein

  • Background :

    Rab5 is a small GTPase of the Ras superfamily that plays a central role in regulating early endocytic trafficking. It cycles between an inactive GDP-bound state and an active GTP-bound state, a process tightly controlled by regulatory proteins such as GEFs, GAPs, and GDIs. In its active form, Rab5 associates with early endosomal membranes, where it recruits effector proteins like EEA1 and Rabaptin-5 to mediate vesicle docking, fusion, and cargo sorting. In neuroscience, Rab5 is essential for maintaining synaptic function and neuronal homeostasis through its regulation of receptor internalization, endosome maturation, and axonal transport. Dysregulation of Rab5 activity has been linked to impaired endosomal trafficking, a hallmark of several neurodegenerative diseases including Alzheimer’s and Parkinson’s. In Alzheimer’s disease, for example, Rab5 overactivation is associated with enlarged early endosomes and disrupted amyloid precursor protein (APP) processing, contributing to amyloid-beta accumulation. Rab5 also plays a role in neurotrophin signaling and synaptic plasticity, making it a key player in both neuronal development and degeneration. Its localization to early endosomes and the plasma membrane makes Rab5 a valuable marker for studying endocytic dysfunction in neurodegenerative models.
  • Description :

    Human Recombinant Rab5 Protein
  • Product Name Alternative :

    Rab5, Rab5A, Ras-related protein Rab-5A, RAS associated protein RAB5A, RAB5A member RAS oncogene family
  • UNSPSC :

    12352202
  • UN Code :

    Non-hazardous
  • Hazard Statement :

    Non-hazardous
  • Gene ID :

    5868
  • Swiss Prot :

    P20339
  • Accession Number :

    BC001267
  • Cellular Locus :

    Cell Membrane | Early Endosome Membrane | Melanosome
  • Expression System :

    E. coli
  • Host :

    E. coli
  • Origin Species :

    Human
  • Target :

    Rab5
  • Conjugation :

    His tag
  • Nature :

    Recombinant
  • Sequence :

    MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
  • Applications :

    WB | SDS-PAGE
  • Field of Research :

    Cancer | Heat Shock
  • Purification Method :

    Affinity Purified
  • Purification :

    Affinity Purified
  • Limit Of Detection :

    This product has been certified >90% pure using SDS-PAGE analysis.
  • Concentration :

    Lot/batch specific. See included datasheet.
  • Purity :

    >90%
  • Weight :

    0.1
  • Buffer :

    20mM Tris/HCl, pH7.5, 0.15M NaCl
  • Molecular Weight :

    ~26 kDa
  • Precautions :

    Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
  • References & Citations :

    1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.
  • Shipping Conditions :

    Blue Ice or 4ºC
  • Storage Conditions :

    -20ºC
  • Background Reference 01 :

    1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.
  • Location :

    Cell Membrane | Early Endosome Membrane | Melanosome
  • AA Sequence :

    MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
  • Immunogen Species :

    Human
MSDS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide