Recombinant Human Double homeobox protein 4 (DUX4), partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS1480694-02	Recombinant Human Double homeobox protein 4C (DUX4L9)
MBS1191771-02	Recombinant Human Double homeobox protein A (DUXA)
MBS1191771-03	Recombinant Human Double homeobox protein A (DUXA)
MBS1191771-04	Recombinant Human Double homeobox protein A (DUXA)
MBS1191771-05	Recombinant Human Double homeobox protein A (DUXA)
MBS1285426-002mgYeast	Recombinant Human Double homeobox protein 5 (DUX5)
MBS1126845-05	Recombinant Human Double homeobox protein 1 (DUX1)
MBS1191771-01	Recombinant Human Double homeobox protein A (DUXA)
MBS1285426-01mgEColi	Recombinant Human Double homeobox protein 5 (DUX5)
MBS1480694-01	Recombinant Human Double homeobox protein 4C (DUX4L9)

CAT:

399-CSB-EP890667HU1-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Double homeobox protein 4 (DUX4), partial

Gene Name: DUX4
UniProt: Q9UBX2
Expression Region: 327-424aa
Organism: Homo sapiens
Target Sequence: AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Stem Cells
Assay Type: Developed Protein
Relevance: Transcription factor that is selectively and transiently expressed in cleavage-stage embryos (PubMed:28459457). Binds to double-stranded DNA elements with the consensus sequence 5'-TAATCTAATCA-3' (PubMed:28459457, PubMed:28459454, PubMed:29572508, PubMed:30540931, PubMed:30315230). Binds to chromatin containing histone H3 acetylated at 'Lys-27' (H3K27ac) and promotes deacetylation of H3K27ac. In parallel, binds to chromatin that lacks histone H3 acetylation at 'Lys-27' (H3K27ac) and recruits EP300 and CREBBP to promote acetylation of histone H3 at 'Lys-27' at new sites (PubMed:26951377). Involved in transcriptional regulation of numerous genes, primarily as transcriptional activator, but mediates also repression of a set of target genes (PubMed:17984056, PubMed:27378237, PubMed:26951377, PubMed:28459457, PubMed:28459454, PubMed:29618456, PubMed:30540931, PubMed:29572508). Promotes expression of ZSCAN4 and KDM4E, two proteins with essential roles during early embryogenesis (PubMed:27378237, PubMed:26951377, PubMed:28459457, PubMed:29618456). Heterologous expression in cultured embryonic stem cells mediates also transcription of HERVL retrotransposons and transcripts derived from ACRO1 and HSATII satellite repeats (PubMed:28459457). May activate expression of PITX1 (PubMed:17984056). May regulate microRNA (miRNA) expression (PubMed:24145033). Inappropriate expression can inhibit myogenesis and promote apoptosis (PubMed:26951377, PubMed:28935672, PubMed:29618456).
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 14.3 kDa
References & Citations: "DUX4, a candidate gene of facioscapulohumeral muscular dystrophy, encodes a transcriptional activator of PITX1." DiXIt M., Ansseau E., Tassin A., Winokur S., Shi R., Qian H., Sauvage S., Matteotti C., van Acker A.M., Leo O., Figlewicz D., Barro M., Laoudj-Chenivesse D., Belayew A., Coppee F., Chen Y.W. Proc. Natl. Acad. Sci. U.S.A. 104:18157-18162 (2007)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Double homeobox protein 4 (DUX4), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Cat

Name

CSB-YP890667HU1-03

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP890667HU1c7-03

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP890667HU1-02

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP890667HU1c7-01

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP890667HU1-03

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-YP890667HU1-02

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP890667HU1c7-02

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-YP890667HU1-01

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP890667HU1-01

Recombinant Human Double homeobox protein 4 (DUX4), partial

CSB-EP001324HUa0-03

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on