Recombinant Human Trefoil factor 3 (TFF3) , partial

CAT:
399-CSB-EP023433HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Trefoil factor 3 (TFF3) , partial - image 1

Recombinant Human Trefoil factor 3 (TFF3) , partial

  • CAS Number:

    9000-83-3
  • Gene Name:

    TFF3
  • UniProt:

    Q07654
  • Expression Region:

    29-80aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
  • Tag:

    N-terminal GST-tagged
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Assay Type:

    In Stock Protein
  • Relevance:

    Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Partial
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    33.2 kDa
  • References & Citations:

    "mRNA 5' region sequence incompleteness: a potential source of systematic errors in translation initiation codon assignment in human mRNAs." Casadei R., Strippoli P., D'Addabbo P., Canaider S., Lenzi L., Vitale L., Giannone S., Frabetti F., Facchin F., Carinci P., Zannotti M. Gene 321:185-193 (2003)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.