IL-7, Rat

• Description:

  IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects. IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E. coli , with His tagged. .

• Product Name Alternative:

  IL-7 Protein, Rat (His), Rat, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/il-7-protein-rat-his.html

• Purity:

  98.0

• Smiles:

  DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI

• Molecular Formula:

  25647 (Gene_ID) NP_037242 (D26-I154) (Accession)

• Molecular Weight:

  Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins