IL-7, Rat

• Description :

  IL-7 Protein regulates T-cell and B-cell development, expansion, and survival, maintaining lymphoid homeostasis. Its interaction with IL7R and CSF2RG receptors is crucial in mediating these effects. IL-7 Protein, Rat is the recombinant rat-derived IL-7 protein, expressed by E. coli , with His tagged. .

• Product Name Alternative :

  IL-7 Protein, Rat (His), Rat, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-7-protein-rat-his.html

• Purity :

  98.0

• Smiles :

  DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI

• Molecular Formula :

  25647 (Gene_ID) NP_037242 (D26-I154) (Accession)

• Molecular Weight :

  Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins