Recombinant Ricinus communis Glycosyltransferase family 92 protein RCOM_0530710 (RCOM_0530710)

CAT:
399-CSB-CF496555RMM-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Ricinus communis Glycosyltransferase family 92 protein RCOM_0530710 (RCOM_0530710) - image 1

Recombinant Ricinus communis Glycosyltransferase family 92 protein RCOM_0530710 (RCOM_0530710)

  • Abbreviation:

    Recombinant Ricinus communis RCOM_0530710 protein
  • Gene Name:

    RCOM_0530710
  • UniProt:

    B9SLR1
  • Expression Region:

    1-552aa
  • Organism:

    Ricinus communis (Castor bean)
  • Target Sequence:

    MKDRRRRETVSWNRFFWCTLLLVLSCVLFTASTFREKFQPEIVSAWRQPAMEATTTIMSTNSPAKPSISIRETVMLPDQVLIFVNYPQSSRLFTKEDFSCVYFSRNSTSLSETQLKKPPNQIDGTDVNNQIVRCPLNPRGFSVSLELKSGGGYINPGPTHRWDSLVYEAMIDRDNTTVVFVKGFNLRADRIYNASKFECVYGWDFRKTKFVLRSNVISIAQEIVRCQTPLSILNNQLKVNNAIKVSIRLKGKGTLHSIARPGVQLLTDPEPGLRGEKPHEMCICTMLRNQGRFLKEWVMYHSQIGVERWFIYDNNSEDDIDSVIESLIDAKFNISRHVWPWVKAQEAGFAHCALRARGLCEWVGFIDVDEFFHLPTGLNLQDAVKNQSNSGNNVAELRVSCHSFGPSGLKHVPAQGVTVGYTCRMMLPERHKSIVKPEALNSTLINVVHHFHLRDGFRYVNADKGILVINHYKYQVWEVFKEKFYRRVATYVVDWQNEQNVGSKDRAPGLGTRAVEPPDWSSRFCEVSDTGLRDRILQNFLDPLTDLLPWQI
  • Tag:

    N-terminal 10xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    In vitro E.coli expression system
  • Field of Research:

    Others
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    64.8 kDa
  • References & Citations:

    "Draft genome sequence of the oilseed species Ricinus communis." Chan A.P., Crabtree J., Zhao Q., Lorenzi H., Orvis J., Puiu D., Melake-Berhan A., Jones K.M., Redman J., Chen G., Cahoon E.B., Gedil M., Stanke M., Haas B.J., Wortman J.R., Fraser-Liggett C.M., Ravel J., Rabinowicz P.D. Nat. Biotechnol. 28:951-956 (2010)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length