SUR2A Antibody, Clone N319A/14

CAT:
400-SMC-431S
Size:
12 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SUR2A Antibody, Clone N319A/14 - image 1

SUR2A Antibody, Clone N319A/14

  • Background:

    Sulfonylurea receptor 2A (SUR2A), encoded by the ABCC9 gene, is a regulatory subunit of ATP-sensitive potassium (KATP) channels, which serve as metabolic sensors linking cellular energy status to membrane excitability. SUR2A partners with Kir6.1 or Kir6.2 subunits to form functional KATP channels, which open or close in response to intracellular ATP and ADP levels. This dynamic regulation allows cells to adapt to metabolic stress by modulating ion flux and electrical activity. While SUR2A is well-characterized in cardiac and skeletal muscle, its emerging role in the central nervous system is gaining attention. In neurons and glial cells, SUR2A-containing KATP channels help maintain ionic homeostasis, protect against excitotoxicity, and support mitochondrial function under stress conditions. These properties are particularly relevant in the context of neurodegenerative diseases, where energy failure, oxidative stress, and inflammation contribute to progressive neuronal loss. Recent studies suggest that SUR2A may influence neurovascular coupling, blood-brain barrier integrity, and neuronal survival pathways—making it a promising target for therapeutic intervention in disorders such as Alzheimer’s disease, Parkinson’s disease, and stroke. Modulating SUR2A activity could offer neuroprotective benefits by enhancing cellular resilience to metabolic and oxidative insults. Understanding the role of SUR2A in brain metabolism and neuroprotection is critical for advancing novel strategies in neurodegenerative disease research.
  • Description:

    Mouse Anti-Mouse SUR2A Monoclonal IgG2A
  • Specifications:

    Detects ~120kDa. Does not cross-react with SUR2B.
  • Product Name Alternative:

    ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A
  • Synonyms:

    SUR2A Antibody, Clone N319A/14
  • UNSPSC:

    12352203
  • UN Code:

    Non-hazardous
  • Hazard Statement:

    Non-hazardous
  • Gene ID:

    20928
  • Swiss Prot:

    P70170
  • Accession Number:

    NP_001038185.1
  • Cellular Locus:

    Membrane
  • Host:

    Mouse
  • Species Reactivity:

    Human, Mouse, Rat
  • Immunogen:

    Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
  • Target:

    SUR2A
  • Clonality:

    Monoclonal
  • Isotype:

    IgG2A
  • Clone:

    N319A/14 (Formerly sold as S319A-14)
  • Conjugation:

    Unconjugated
  • Type:

    Monoclonal
  • Applications:

    WB | IHC | ICC/IF
  • Validated Applications:

    WB, IHC, ICC/IF
  • Field of Research:

    Neuroscience | Cell Markers | Neuron Markers | Membrane Markers | Cell Signaling | Cancer
  • Purification:

    Protein G Purified
  • Limit Of Detection:

    1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
  • Concentration:

    1 mg/ml
  • Dilution:

    WB (1:1000) ; optimal dilutions for assays should be determined by the user.
  • Weight:

    0.012
  • Buffer:

    PBS pH7.4, 50% glycerol, 0.1% sodium azide
  • Precautions:

    Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
  • References & Citations:

    1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042. 2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
  • Shipping Conditions:

    Blue Ice or 4ºC
  • Storage Conditions:

    -20ºC
  • Specificity:

    Detects ~120kDa. Does not cross-react with SUR2B.
  • Background Reference 01:

    1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4 (11) : 1038-1042. 2. Nichols C.G. (2006) Nature. 440 (7083) : 470-476.
  • Species:

    Human | Mouse | Rat
  • CAS Number:

    9007-83-4
  • Location:

    Membrane
  • Isotype:

    IgG2A
  • Immunogen Species:

    Mouse