SUR2A Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SUR2A Antibody
Gene Name:
ATP-binding cassette, sub-family C (CFTR/MRP), member 9Gene Aliases:
ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2AGene ID:
20928Accession Number:
NP_001038185.1Reactivity:
Human, Mouse, RatImmunogen:
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2AClonality:
MonoclonalClone:
S319A-14Conjugation:
UnconjugatedType:
Monoclonal AntibodyApplications:
WB, IHC, ICC, IFPurification:
Protein G PurifiedAssay Protocol:
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolConcentration:
1 mg/mlDilution:
WB (1:1000) ; optimal dilutions for assays should be determined by the user.Format:
Liquid.// PBS, pH 7.4 with 0.1% sodium azide and 50% glycerol.Reconstitution:
Store at -20° C for one year. Avoid freeze/thaw cycles.Fragment:
IgG2ASpecificity:
Detects ~120kDa. Does not cross-react with SUR2B.NCBI Gene Symbol:
SUR2AHost or Source:
MouseGene Name URL:
SUR2ACAS Number:
9007-83-4
