Products for Research Use Only
RegisterLogin

NECAP2, Human (His)

CAT: 0804-HY-P70922Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70922Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
Product Name Alternative
NECAP2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/necap2-protein-human-his.html
Smiles
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
Molecular Formula
55707 (Gene_ID) Q9NVZ3 (M1-F263) (Accession)
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS09173NECAP2 Human Pre-designed siRNA Set A
HY-RS19517Necap2 Mouse Pre-designed siRNA Set A
HY-RS26012Necap2 Rat Pre-designed siRNA Set A
HY-P70573A-01IRF5, Human (His)
HY-P705610METTL14, Human (His)
HY-P705479-01SFTPA1, Human (His)
HY-P705446RAF1, Human (His)
HY-P705436TIA1, Human (His)
HY-P705431METTL7B, Human (His)
HY-P705422-01NAT1, Human (His)

Alternative Products

CatalogName
TMPJ-01356-01NECAP2 Protein, Human, Recombinant (His)
P517157NECAP2 Protein (N-His & C-His, Human)
PKSH032045-01Recombinant Human NECAP2 Protein (His Tag)
E40KMH1438Recombinant Human NECAP2 Protein, His Tag
047174-01NECAP2, Recombinant, Human, His-Tag discontinued
YHP29701Recombinant Human NECAP2 Protein, N-His & C-His
AR09913PU-LNECAP2 (1-263, His-tag) Human Protein
PV028044NECAP2 Protein Vector (Human) (pPM-C-His)
PV028041NECAP2 Protein Vector (Human) (pPB-C-His)
PV028042NECAP2 Protein Vector (Human) (pPB-N-His)

Popular Products