Recombinant Human C-X-C motif chemokine 2 (CXCL2)

CAT:
399-CSB-EP006248HU-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human C-X-C motif chemokine 2 (CXCL2) - image 1

Recombinant Human C-X-C motif chemokine 2 (CXCL2)

  • CAS Number:

    9000-83-3
  • Gene Name:

    CXCL2
  • UniProt:

    P19875
  • Expression Region:

    35-107aa
  • Organism:

    Homo sapiens
  • Target Sequence:

    APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
  • Tag:

    N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Assay Type:

    In Stock Protein
  • Relevance:

    Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta (5-73) shows a highly enhanced hematopoietic activity.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    44.5 kDa
  • References & Citations:

    "Identification of unique truncated KC/GRO beta chemokines with potent hematopoietic and anti-infective activities." King A.G., Johanson K., Frey C.L., DeMarsh P.L., White J.R., McDevitt P., McNulty D., Balcarek J., Jonak Z.L., Bhatnagar P.K., Pelus L.M. J. Immunol. 164:3774-3782 (2000)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.