Recombinant Human C-X-C motif chemokine 10 (CXCL10)

CAT:
399-CSB-EP006240HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human C-X-C motif chemokine 10 (CXCL10) - image 1

Recombinant Human C-X-C motif chemokine 10 (CXCL10)

  • Product Name Alternative:

    10KDA interferon gamma-induced protein ; Gamma-IP10 ; IP-10Small-inducible cytokine B10
  • Abbreviation:

    Recombinant Human CXCL10 protein
  • Gene Name:

    CXCL10
  • UniProt:

    P02778
  • Expression Region:

    22-98aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Immunology
  • Relevance:

    Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
  • Molecular Weight:

    12.6 kDa
  • References & Citations:

    Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P.Eur. J. Biochem. 268:4992-4999 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein