TXN2, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TXN2, Human
Description :
As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability.Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health.TXN2 Protein, Human is the recombinant human-derived TXN2 protein, expressed by E.coli , with tag free.Product Name Alternative :
TXN2 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/txn2-protein-human-his.htmlPurity :
98.0Smiles :
TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIGMolecular Formula :
25828 (Gene_ID) Q99757 (T60-G166) (Accession)Molecular Weight :
Approximately 13 kDaShipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

