TXN2, Human

CAT:
804-HY-P71393-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
TXN2, Human - image 1

TXN2, Human

  • Description :

    As a monomer, the TXN2 protein is critical for maintaining mitochondrial reactive oxygen species (ROS) homeostasis, regulating apoptosis, and ensuring cell viability.Its unique dithiol reducing activity fine-tunes cellular redox balance, making a significant contribution to overall cellular health.TXN2 Protein, Human is the recombinant human-derived TXN2 protein, expressed by E.coli , with tag free.
  • Product Name Alternative :

    TXN2 Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/txn2-protein-human-his.html
  • Purity :

    98.0
  • Smiles :

    TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
  • Molecular Formula :

    25828 (Gene_ID) Q99757 (T60-G166) (Accession)
  • Molecular Weight :

    Approximately 13 kDa
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide