Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

CAT:
399-CSB-MP887932AKE-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 - image 1

Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595

  • UniProt:

    Q9GZ28
  • Expression Region:

    1-62aa
  • Organism:

    Anemonia sulcata (Mediterranean snakelocks sea anemone)
  • Target Sequence:

    MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
  • Tag:

    C-terminal hFc-tagged
  • Source:

    Mammalian cell
  • Field of Research:

    Bioluminescence
  • Assay Type:

    In Stock Protein
  • Relevance:

    Pigment protein that is intensely purple in color.
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Length:

    Full Length of Mature Protein
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    35.7 kDa
  • References & Citations:

    "Natural animal coloration can be determined by a nonfluorescent green fluorescent protein homolog." Lukyanov K.A., Fradkov A.F., Gurskaya N.G., Matz M.V., Labas Y.A., Savitsky A.P., Markelov M.L., Zaraisky A.G., Zhao X., Fang Y., Tan W., Lukyanov S.A. J. Biol. Chem. 275:25879-25882 (2000)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
  • CAS Number:

    9000-83-3