Recombinant Anemonia sulcata Delta-actitoxin-Avd1c

• Product Name Alternative:

  ATX-II

• Abbreviation:

  Recombinant Anemonia sulcata Delta-actitoxin-Avd1c protein

• UniProt:

  P01528

• Expression Region:

  1-47aa

• Organism:

  Anemonia sulcata (Mediterranean snakelocks sea anemone)

• Target Sequence:

  GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC (50) =6.01 nM) and Nav1.2/SCN2A (EC (50) =7.88 nM) (PubMed:15169781) . It has also great activity on Nav1.5/SCN5A (EC (50) =49.05 nM), Nav1.4/SCN4A (EC (50) =109.49 nM) and Nav1.6/SCN8A (EC (50) =about 180 nM) and is less potent on Nav1.3/SCN3A (EC (50) =759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781) .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC (50) =6.01 nM) and Nav1.2/SCN2A (EC (50) =7.88 nM)

• Molecular Weight:

  6.9 kDa

• References & Citations:

  "Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone."Hartung K., Rathmayer W.Pflugers Arch. 404:119-125 (1985)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length