Login

Recombinant Human Proheparin-binding EGF-like growth factor (HBEGF) , partial

CAT:
399-CSB-YP857429HU-03
Size:
1 mg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Proheparin-binding EGF-like growth factor (HBEGF) , partial - image 1
Recombinant Human Proheparin-binding EGF-like growth factor (HBEGF) , partial - image 2
Thumbnail 1
Thumbnail 2

Recombinant Human Proheparin-binding EGF-like growth factor (HBEGF) , partial

  • CAS Number: 9000-83-3
  • Gene Name: HBEGF
  • UniProt: Q99075
  • Expression Region: 63-148aa
  • Organism: Homo sapiens
  • Target Sequence: DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
  • Tag: C-terminal 6xHis-tagged
  • Source: Yeast
  • Field of Research: Cancer
  • Assay Type: Developed Protein
  • Relevance: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
  • Purity: Greater than 85% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Partial
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function: Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
  • Molecular Weight: 11.7 kDa
  • References & Citations: "A heparin-binding growth factor secreted by macrophage-like cells that is related to EGF." Higashiyama S., Abraham J.A., Miller J., Fiddes J.C., Klagsbrun M. Science 251:936-939 (1991)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.