Recombinant Human Fatty acid-binding protein (FABP5) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
P1658-.5	Recombinant Human Fatty acid binding protein3
MBS1090546-03	Recombinant Human Fatty acid desaturase 2
B2018753	Fatty Acid Desaturase 1 Human Recombinant
MBS952666-INQUIRE	Recombinant Human Fatty aldehyde dehydrogenase (ALDH3A2)
MBS1090546-02	Recombinant Human Fatty acid desaturase 2
B2017397	Fatty Acid Desaturase 2 Human Recombinant
B2018716	Fatty Acid Desaturase 2 Human Recombinant
B2017434	Fatty Acid Desaturase 1 Human Recombinant
MBS1090546-01	Recombinant Human Fatty acid desaturase 2
MBS1090546-04	Recombinant Human Fatty acid desaturase 2

Recombinant Human Fatty acid-binding protein (FABP5)

CAT:

399-CSB-EP007946HUe0-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Fatty acid-binding protein (FABP5)

Gene Name: FABP5
UniProt: Q01469
Expression Region: 1-135aa
Organism: Homo sapiens
Target Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Tag: N-terminal GST-tagged
Source: E.coli
Field of Research: Cardiovascular
Assay Type: Developed Protein
Relevance: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
Molecular Weight: 42.2 kDa
References & Citations: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." Gevaert K., Goethals M., Martens L., Van Damme J., Staes A., Thomas G.R., Vandekerckhove J. Nat. Biotechnol. 21:566-569 (2003)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Fatty acid-binding protein (FABP5), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-EP008435HU-01	Recombinant Human Fatty acid synthase (FASN), partial
CSB-EP007946HUe0-02	Recombinant Human Fatty acid-binding protein (FABP5)
CSB-EP007946HUe0-03	Recombinant Human Fatty acid-binding protein (FABP5)
CSB-EP007946HUe0-01	Recombinant Human Fatty acid-binding protein (FABP5)
CSB-EP008435HU-03	Recombinant Human Fatty acid synthase (FASN), partial
CSB-EP008435HU-02	Recombinant Human Fatty acid synthase (FASN), partial
CSB-EP007946HU-03	Recombinant Human Fatty acid-binding protein 5 (FABP5)
CSB-EP001624HUd7-03	Recombinant Human Polyunsaturated fatty acid 5-lipoxygenase (ALOX5)
CSB-YP007942HUa0-03	Recombinant Human Fatty acid-binding protein, intestinal (FABP2)
CSB-YP007942HU-03	Recombinant Human Fatty acid-binding protein, intestinal (FABP2)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on