DCIP-1/CXCL3, Mouse

CXCL3 is a chemoattractant for neutrophils and belongs to CXC chemokine subfamily. CXCL3 is a secreted growth factor that signals through its cognate receptor CXCR2. CXCL3 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. DCIP-1/CXCL3 Protein, Mouse is produced in E. coli , and consists of 73 amino acids (A28-S100) .

DCIP-1/CXCL3 Protein, Mouse, Mouse, E. coli

12352202

Recombinant Proteins

https://www.medchemexpress.com/cytokines/dcip-1-cxcl3-protein-mouse.html

98.0

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

[1]Smith DF, et al. GRO family chemokines are specialized for monocyte arrest from flow. Am J Physiol Heart Circ Physiol. 2005 Nov;289 (5) :H1976-84.|[2]Farioli-Vecchioli S, et al. Tis21 knock-out enhances the frequency of medulloblastoma in Patched1 heterozygous mice by inhibiting the Cxcl3-dependent migration of cerebellar neurons.J Neurosci. 2012 Oct 31;32 (44) :15547-64.|[3]Niradiz Reyes, et al. CXCL3 Signaling in the Tumor Microenvironment. Adv Exp Med Biol. 2021;1302:15-24.|[4]Joji Kusuyama, et al. CXCL3 positively regulates adipogenic differentiation. J Lipid Res. 2016 Oct;57 (10) :1806-1820.|[5]Khushboo Gulati, et al. Molecular cloning and biophysical characterization of CXCL3 chemokine. Int J Biol Macromol. 2018 Feb;107 (Pt A) :575-584.|[6]Jinru Weng, et al. CXCL3 overexpression affects the malignant behavior of oral squamous cell carcinoma cells via the MAPK signaling pathway. J Oral Pathol Med. 2021 Oct;50 (9) :902-910.|[7]Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191 (5) :2731-41.|[8]Manuela Ceccarelli, et al. Suppression of Medulloblastoma Lesions by Forced Migration of Preneoplastic Precursor Cells with Intracerebellar Administration of the Chemokine Cxcl3. Front Pharmacol. 2016 Dec 16;7:484.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years