Products for Research Use Only
RegisterLogin

RecombinantDCIP-1/CXCL3, Mouse

CAT: 0013-GTR18990441-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990441-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP­2b. CXCL3 controls migration and adhesion of monocytes and mediates its effect on its target cell by interacting with cell surface chemokine receptor CXCR2. It has been shown that CXCL3 regulates the migration of precursors of cerebellar granule neurons toward the internal layers of cerebellum, during morphogenesis. Recombinant mouse DCIP-1/CXCL3 produced in CHO cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmDCIP-1/CXCL3 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
DCIP-1, CXCL3
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of mouse DCIP-1/CXCL3 on Caˆ2+ mobilization assay in CHO-K1/Ga15/mCXCR2 cells (human Ga15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 100 ng/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Mouse DCIP-1°CXCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse DCIP-1°CXCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Related Products

CatalogName
GTR18991653-01Recombinant Mouse Dendritic Cell Inflammatory Protein 1/CXCL3 (rMuDCIP-1/CXCL3)
GTR19340711-01CXCL3 siRNA (Mouse)
GTR18881878-01Mouse Cxcl3 protein
GTR18685430-01CXCL3 Mouse Monoclonal Antibody
GTR18817327-01Mouse CXCL3 ELISA Kit
GTR18838745Mouse CXCL3 ELISA Kit
GTR18820547Mouse CXCL3 ELISA Kit
GTR18882324-01Mouse CXCL3 protein (Active)
GTR18234925-01CXCL3 Antibody
GTR18059764CXCL3 Antibody

Alternative Products

CatalogName
BK0192RecombinantDCIP-1/CXCL3,Mouse
BK0192-01RecombinantDCIP-1/CXCL3, Mouse
HY-P7153-01DCIP-1/CXCL3, Mouse
MBS8575402-01CXCL3, Mouse
JOT-PR2001Recombinant Mouse Dendritic Cell Inflammatory Protein 1/CXCL3 (rMuDCIP-1/CXCL3)
5568-CA-025Recombinant Mouse CXCL3/DCIP-1
HY-P700003-01DCIP-1/CXCL3, Mouse (CHO)
PR2001-01Recombinant Mouse Dendritic Cell Inflammatory Protein 1/CXCL3 (rMuDCIP-1/CXCL3)
17176054CXCL3 Adenovirus (Mouse)
abx913253-01Mouse CXCL3 siRNA

Popular Products