Products for Research Use Only

IFN-gamma, Human

CAT: 0804-HY-P7025-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7025-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.
Product Name Alternative
IFN-gamma Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-human.html
Purity
98.0
Smiles
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular Formula
3458 (Gene_ID) P01579 (Q24-Q166) (Accession)
Molecular Weight
Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60.|[2]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.|[3]Jiang Z, et al., IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. Nat Microbiol. 2021 Jul;6 (7) :932-945.|[4]Gao L, et al., MiR-873/PD-L1 axis regulates the stemness of breast cancer cells. EBioMedicine. 2019 Mar;41:395-407.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins