Products for Research Use Only
RegisterLogin

IFN-gamma, Mouse

CAT: 0804-HY-P7071-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7071-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag[1][2][3][4].
Product Name Alternative
IFN-gamma Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-mouse.html
Purity
98.0
Smiles
HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Molecular Formula
15978 (Gene_ID) P01580 (H23-C155) (Accession)
Molecular Weight
Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.|[2]Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81.|[3]Chesler DA, et al. The role of IFN-gamma in immune responses to viral infections of the central nervous system. Cytokine Growth Factor Rev. 2002 Dec;13 (6) :441-54.|[4]Goedhart M, et al. Interferon-Gamma Impairs Maintenance and Alters Hematopoietic Support of Bone Marrow Mesenchymal Stromal Cells. Stem Cells Dev. 2018 May 1;27 (9) :579-589.|[5]Tu J, et al. Nintedanib enhances the efficacy of PD-L1 blockade by upregulating MHC-I and PD-L1 expression in tumor cells. Theranostics. 2022 Jan 1;12 (2) :747-766.|[6]Lee YM, et al. IFN-gamma production during initial infection determines the outcome of reinfection with respiratory syncytial virus. Am J Respir Crit Care Med. 2008 Jan 15;177 (2) :208-18.|[7]Talmadge JE, et al. Immunomodulatory and immunotherapeutic properties of recombinant gamma-interferon and recombinant tumor necrosis factor in mice. Cancer Res. 1987 May 15;47 (10) :2563-70.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P85211IFN gamma Antibody (YA4903, Mouse)
HY-P7025-01IFN-gamma, Human
HY-P79280-01IFN-gamma, Feline
HY-P7095-01IFN-gamma, Rat
HY-P79429-01IFN-gamma, Porcine
HY-P79295-01IFN-gamma, Canine
HY-P74852AIFN-gamma R2, Mouse (HEK293, His)
HY-P99136-01Anti-Mouse IFN gamma Antibody (H22)
HY-P7025A-01IFN-gamma, Human (CHO)
HY-P7095A-01IFN-gamma, Rat (CHO)

Alternative Products

CatalogName
BP118-1mgMouse IFN-gamma
E34M052MIFN gamma, Mouse
RC99022Mouse IFN Gamma
RP00551Recombinant Mouse IFN-gamma/IFNγ Protein
P3167-.01Recombinant Mouse IFN-gamma
30R-AI070xIFN gamma protein (Mouse)
CM40-01Recombinant Mouse IFN gamma
GTR18905865-01Mouse IFN gamma protein
GTR18578416-01Mouse IFN gamma Antibody
GTR18866668Mouse IFN gamma ELISpot

Popular Products