Recombinant Human Lymphocyte antigen 96 (LY96) | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS146916-03	Recombinant Human Lymphocyte Antigen 9
MBS146916-04	Recombinant Human Lymphocyte Antigen 9
MBS9421140-01	Recombinant Human Lymphocyte antigen 6E
MBS9421140-02	Recombinant Human Lymphocyte antigen 6E
MBS9421140-04	Recombinant Human Lymphocyte antigen 6E
MBS1448995-02	Recombinant Human Lymphocyte antigen 6E
MBS1448995-03	Recombinant Human Lymphocyte antigen 6E
MBS146059-02	Recombinant Human Lymphocyte Antigen 86
MBS146916-01	Recombinant Human Lymphocyte Antigen 9
MBS9421140-03	Recombinant Human Lymphocyte antigen 6E

Recombinant Human Lymphocyte antigen 96 (LY96)

CAT:

399-CSB-EP013254HU(A4)a0-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Lymphocyte antigen 96 (LY96)

Gene Name: LY96
UniProt: Q9Y6Y9
Expression Region: 19-160aa
Organism: Homo sapiens
Target Sequence: QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Immunology
Assay Type: In Stock Protein
Relevance: Binds bacterial lipopolysaccharide (LPS). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Bioactivity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 23.5 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Lymphocyte antigen 96 (LY96), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-YP013249HU-03	Recombinant Human Lymphocyte antigen 6H (LY6H)
CSB-YP013249HU-01	Recombinant Human Lymphocyte antigen 6H (LY6H)
CSB-EP619076HUc7-01	Recombinant Human Lymphocyte antigen 6E (LY6E)
CSB-EP619076HUc7-02	Recombinant Human Lymphocyte antigen 6E (LY6E)
CSB-EP013252HUb1-02	Recombinant Human Lymphocyte antigen 86 (LY86)
CSB-EP013254HU(A4)a0-02	Recombinant Human Lymphocyte antigen 96 (LY96)
CSB-EP013254HU(A4)a0-03	Recombinant Human Lymphocyte antigen 96 (LY96)
CSB-EP619076HU-03	Recombinant Human Lymphocyte antigen 6E (LY6E)
CSB-EP619076HU-01	Recombinant Human Lymphocyte antigen 6E (LY6E)
CSB-EP619076HU-02	Recombinant Human Lymphocyte antigen 6E (LY6E)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on