Recombinant Human Lymphocyte antigen 6E (LY6E) (Active)

• Product Name Alternative:

  Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein (RIG-E) ; Stem cell antigen 2 (SCA-2) ; Thymic shared antigen 1 (TSA-1) ; LY6E; 9804, RIGE, SCA2, TSA1

• Abbreviation:

  Recombinant Human LY6E protein (Active)

• Gene Name:

  LY6E

• UniProt:

  Q16553

• Expression Region:

  21-101aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

• Tag:

  N-terminal hFc-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cell Biology

• Relevance:

  GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human LY6E protein at 2 μg/mL can bind Anti-LY6E recombinant antibody (CSB-RA619076MA1HU) . The EC50 is 2.483-3.282 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  34.6 kDa

• References & Citations:

  Innovative biomarkers TCN2 and LY6E can significantly inhibit respiratory syncytial virus infection. Cao B., Li M., Li X., Ji X., Wan L., Jiang Y., Zhou L., Gong F., Chen X. J Transl Med 22:854-854 (2024)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein