Recombinant Human Thioredoxin (TXN)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS9421632-02	Recombinant Human Thioredoxin
MBS635789-02	Thioredoxin, Recombinant, Human
MBS143120-01	Recombinant Human Thioredoxin
MBS717063-03	Recombinant Human Thioredoxin
6305-100	Human Recombinant Thioredoxin
MBS9421632-04	Recombinant Human Thioredoxin
MBS635789-01	Thioredoxin, Recombinant, Human
MBS635789-03	Thioredoxin, Recombinant, Human
7-06760	Recombinant Human Thioredoxin
rAP-4947	Thioredoxin Human Recombinant

CAT:

399-CSB-EP025365HU-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Thioredoxin (TXN)

Gene Name: TXN
UniProt: P10599
Expression Region: 2-105aa
Organism: Homo sapiens
Target Sequence: VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Tag: N-terminal GST-tagged
Source: E.coli
Field of Research: Transport
Assay Type: In Stock Protein
Relevance: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION
Molecular Weight: 38.6 kDa
References & Citations: Cloning and expression of a cDNA for human thioredoxin.Wollman E.E., D'Auriol L., Rimsky L., Shaw A., Jacquot J.-P., Wingfield P., Graber P., Dessarps F.J. Biol. Chem. 263:15506-15512 (1988)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Thioredoxin (TXN), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-EP025365HU-03	Recombinant Human Thioredoxin (TXN)
CSB-EP025365HU-01	Recombinant Human Thioredoxin (TXN)
CSB-EP025365HU-02	Recombinant Human Thioredoxin (TXN)
CSB-EP857458HU-03	Recombinant Human Thioredoxin, mitochondrial (TXN2)
CSB-AP005541HU-01	Recombinant Human Thioredoxin (TXN) (Active)
CSB-AP005541HU-03	Recombinant Human Thioredoxin (TXN) (Active)
CSB-EP857458HU-01	Recombinant Human Thioredoxin, mitochondrial (TXN2)
CSB-EP857458HU-02	Recombinant Human Thioredoxin, mitochondrial (TXN2)
CSB-AP005541HU-02	Recombinant Human Thioredoxin (TXN) (Active)
CSB-RP028144h-02	Human Thioredoxin (TXN)