Recombinant Mouse Fatty acid-binding protein, liver protein (Fabp1) (Active)

CAT:
399-CSB-AP000551MO-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Fatty acid-binding protein, liver protein (Fabp1) (Active) - image 1

Recombinant Mouse Fatty acid-binding protein, liver protein (Fabp1) (Active)

  • Product Name Alternative:

    14 kDa selenium-binding protein, Liver-type fatty acid-binding protein, L-FABP
  • Abbreviation:

    Recombinant Mouse Fabp1 protein (Active)
  • Gene Name:

    Fabp1
  • UniProt:

    P12710
  • Expression Region:

    1-127aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI
  • Tag:

    Tag-Free
  • Type:

    Active Protein & In Stock Protein
  • Source:

    E.Coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. Also seems to bind selenium.
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    >95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
  • Molecular Weight:

    14.2 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length