IL-1beta, Human (solution)

• Description :

  IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (solution) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  IL-1 beta Protein, Human (solution), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-1b-human.html

• Purity :

  98.0

• Smiles :

  APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Molecular Formula :

  3553 (Gene_ID) P01584 (A117-S269) (Accession)

• Molecular Weight :

  Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins