Recombinant Rat Growth-regulated alpha protein (Cxcl1) (Active)

Recombinant Rat Growth-regulated alpha protein (Cxcl1) (Active)

• CAS Number: 9000-83-3
• Gene Name: Cxcl1, Cinc1, Gro, Scyb1
• UniProt: P14095
• Expression Region: 25-96aa
• Organism: Rattus norvegicus
• Target Sequence: APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
• Tag: Tag-Free
• Source: E.Coli
• Field of Research: Immunology
• Assay Type: Active Protein & In Stock Protein
• Relevance: Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation.
• Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
• Purity: >97% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaXIs bioassay using rat neutrophils is in a concentration range of 10-100 ng/ml.
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Function: Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation.
• Molecular Weight: 7.8 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.