Recombinant Human Growth-regulated alpha protein (CXCL1)

• Gene Name:

  CXCL1

• UniProt:

  P09341

• Expression Region:

  35-107aa

• Organism:

  Homo sapiens

• Target Sequence:

  ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

• Tag:

  N-terminal 6xHis-tagged

• Source:

  E.coli

• Field of Research:

  Immunology

• Assay Type:

  Developed Protein

• Relevance:

  Has chotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha (4-73), GRO-alpha (5-73) and GRO-alpha (6-73) show a 30-fold higher chotactic activity.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Length:

  Full Length of Mature Protein

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha (4-73), GRO-alpha (5-73) and GRO-alpha (6-73) show a 30-fold higher chemotactic activity.

• Molecular Weight:

  11.9 kDa

• References & Citations:

  Constitutive overexpression of a growth-regulated gene in transformed Chinese hamster and human cells.Anisowicz A., Bardwell L., Sager R.Proc. Natl. Acad. Sci. U.S.A. 84:7188-7192 (1987)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

• CAS Number:

  9000-83-3