Recombinant Bovine Interferon gamma (IFNG)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
IFN-a-62B	Recombinant Bovine Interferon-Alpha
MBS225398-02	Recombinant Bovine Interferon Beta
MBS232521-02	RECOMBINANT BOVINE INTERFERON GAMMA
MBS650185-02	Interferon, gamma, Recombinant, Bovine
MBS232521-01	RECOMBINANT BOVINE INTERFERON GAMMA
MBS225398-01	Recombinant Bovine Interferon Beta
MBS650185-01	Interferon, gamma, Recombinant, Bovine
MBS1006901-04	Recombinant Bovine Interferon alpha-1
MBS1131960-01	Recombinant Bovine Interferon tau-1
MBS1131960-03	Recombinant Bovine Interferon tau-1

CAT:

399-CSB-EP011050BO-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Bovine Interferon gamma (IFNG)

Gene Name: IFNG
UniProt: P07353
Expression Region: 24-166aa
Organism: Bos taurus
Target Sequence: QGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWKDESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Cancer
Assay Type: Developed Protein
Relevance: Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 21.0 kDa
References & Citations: "The 2.0-A structure of bovine interferon-gamma; assessment of the structural differences between species." Randal M., Kossiakoff A.A. Acta Crystallogr. D 56:14-24 (2000)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Bovine Interferon gamma (IFNG), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-EP011050BO-02	Recombinant Bovine Interferon gamma (IFNG)
CSB-EP011050BO-01	Recombinant Bovine Interferon gamma (IFNG)
CSB-EP011050BO-03	Recombinant Bovine Interferon gamma (IFNG)
CSB-EP362113BO-03	Recombinant Bovine Interferon alpha-1
CSB-EP362113BO-02	Recombinant Bovine Interferon alpha-1
CSB-EP362113BO-01	Recombinant Bovine Interferon alpha-1
CSB-EP322795BO-01	Recombinant Bovine Interferon tau-1 (IFNT1)
CSB-EP011061BO-02	Recombinant Bovine Interferon omega-1 (IFNW1)
CSB-EP011061BO-01	Recombinant Bovine Interferon omega-1 (IFNW1)
CSB-YP344226BO-01	Recombinant Bovine Interferon alpha-G (IFNAG)