Recombinant Bovine Interferon alpha-1
CAT:
399-CSB-EP362113BO-01
Size:
20 µg
For Laboratory Research Only. Not for Clinical or Personal Use.
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Bovine Interferon alpha-1
Abbreviation:
Recombinant Bovine Interferon alpha-1 proteinUniProt:
P07348Expression Region:
24-189aaOrganism:
Bos taurus (Bovine)Target Sequence:
CHLPHSHSLAKRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAVWDESLLDRLRTALDQQLTDLQACLR QEEGLPGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAQVMRAFSSSTNLQERFRRKDTag:
N-terminal 10xHis-tagged and C-terminal Myc-taggedType:
Developed ProteinSource:
E.coliField of Research:
CancerRelevance:
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.Endotoxin:
Not testPurity:
Greater than 90% as determined by SDS-PAGE.Activity:
Not TestForm:
Liquid or Lyophilized powderBuffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
26.5 kDaReferences & Citations:
"Two distinct families of human and bovine interferon-alpha genes are coordinately expressed and encode functional polypeptides." Capon D.J., Shepard H.M., Goeddel D.V. Mol. Cell. Biol. 5:768-779 (1985)Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Protein Length:
Full Length of Mature Protein
