Products for Research Use Only
RegisterLogin

BCA-1/CXCL13, Human

CAT: 0804-HY-P7131-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7131-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CXCL13, known as BCA-1 (B cell-attracting chemokine 1) or BLC (B-lymphocyte chemoattractant), is an efficacious attractant selective for B lymphocytes through binding to the BLR1/CXCR5 receptor[1]. CXCL13 is a homeostatic chemokine, and is constitutively secreted by stromal cells in B-cell areas of secondary lymphoid tissues (follicles), such as spleen, lymph nodes, tonsils, and Peyer's patches[2]. BCA-1/CXCL13 Protein, Human is produced in E. coli, and consists of 87 amino acids (V23-P109) .
Product Name Alternative
BCA-1/CXCL13 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bca-1-cxcl13-protein-human.html
Purity
98.00
Smiles
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Molecular Formula
10563 (Gene_ID) O43927 (V23-P109) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Jenh CH, et al. Human B cell-attracting chemokine 1 (BCA-1; CXCL13) is an agonist for the human CXCR3 receptor. Cytokine. 2001 Aug 7;15 (3) :113-21.|[2]Muzammal Hussain, et al. CXCL13/CXCR5 signaling axis in cancer. Life Sci. 2019 Jun 15;227:175-186.|[3]Marcelo G Kazanietz, et al. CXCL13 and Its Receptor CXCR5 in Cancer: Inflammation, Immune Response, and Beyond. Front Endocrinol (Lausanne) . 2019 Jul 12;10:471.|[4]Bao-Chun Jiang, et al. CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5. J Clin Invest. 2016 Feb;126 (2) :745-61.|[5]Y Sambandam, et al. CXCL13 activation of c-Myc induces RANK ligand expression in stromal/preosteoblast cells in the oral squamous cell carcinoma tumor-bone microenvironment. Oncogene. 2013 Jan 3;32 (1) :97-105.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P76164-01BCA-1/CXCL13, Cynomolgus (His)
HY-P77912-01BCA-1/CXCL13, Mouse (HEK293, Fc)
HY-P77911-01BCA-1/CXCL13, Mouse (HEK293, His)
HY-P700547-01BCA-1/CXCL13, Rat (His-GST)
HY-15908-01BCA
HY-K2002-01BCA Protein Assay Kit
HY-RS03387CXCL13 Human Pre-designed siRNA Set A
HY-P87311-01CXCL13 Antibody (YA6994, Rabbit)
HY-P700234AFAnimal-Free CXCL13, Pig (His)
HY-RS23036Cxcl13 Rat Pre-designed siRNA Set A

Alternative Products

CatalogName
Z02826-20BCA-1/CXCL13, Human
RC312-24BCA-1, CXCL13, human
MBS553043-01Human BCA-1 (CXCL13) Recombinant
MBS4159637-01Recombinant Human BCA-1 (CXCL13)
P1215-.5Recombinant Human BCA-1/CXCL13
PT_40333-01BCA-1/BLC Human Recombinant (CXCL13) (BCA 1 Human)
MBS2569295-01Recombinant Human CXCL13/BCA-1 Protein
CD02280Recombinant Human BCA-1/CXCL13 protein
7-01778Recombinant Human BCA-1/ BLC (CXCL13)
Z05204-500CXCL13/BCA-1 hFc Chimera, Human

Popular Products