LL-37 scrambled peptide (acetate)
CAT:
804-HY-P1513A-01
Size:
5 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
LL-37 scrambled peptide (acetate)
- UNSPSC Description: LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
- Target Antigen: Bacterial
- Type: Peptides
- Related Pathways: Anti-infection
- Applications: COVID-19-immunoregulation
- Field of Research: Infection
- Assay Protocol: https://www.medchemexpress.com/ll-37-scrambled-peptide-acetate.html
- Purity: 99.79
- Solubility: 10 mM in DMSO
- Smiles: [GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR (acetate)]
- Molecular Weight: 4493.30 (free acid)
- References & Citations: [1]Gerard Sheehan, et al. The Human Cathelicidin Antimicrobial Peptide LL-37 Promotes the Growth of the Pulmonary Pathogen Aspergillus fumigatus. Infect Immun. 2018 Jun 21;86(7):e00097-18.
- Shipping Conditions: Blue Ice
- Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
- Clinical Information: No Development Reported