LL-37 scrambled peptide (acetate)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


LL-37 scrambled peptide (acetate)
UNSPSC Description:
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.Target Antigen:
BacterialType:
PeptidesRelated Pathways:
Anti-infectionApplications:
COVID-19-immunoregulationField of Research:
InfectionAssay Protocol:
https://www.medchemexpress.com/ll-37-scrambled-peptide-acetate.htmlPurity:
99.79Solubility:
10 mM in DMSOSmiles:
[GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR (acetate)]Molecular Weight:
4493.30 (free acid)References & Citations:
[1]Gerard Sheehan, et al. The Human Cathelicidin Antimicrobial Peptide LL-37 Promotes the Growth of the Pulmonary Pathogen Aspergillus fumigatus. Infect Immun. 2018 Jun 21;86(7):e00097-18.Shipping Conditions:
Blue IceStorage Conditions:
-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)Clinical Information:
No Development Reported
