Recombinant Human Kit ligand (KITLG), partial

CAT: 0399-CSB-EP012376HU-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0399-CSB-EP012376HU-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Product Name Alternative

Mast cell growth factor ; MGFStem cell factor ; SCFc-Kit ligand

Abbreviation

Recombinant Human KITLG protein, partial

Gene Name

KITLG

UniProt

P21583

Expression Region

26-189aa

Organism

Homo sapiens (Human)

Target Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hatopoiesis, st cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family mbers STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Molecular Weight

45.5 kDa

References & Citations

The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

UniProtKB · P21583

Kit ligand

SCF_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P21583
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: KITLG
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A0AV09, A8K2Q4, B7ZLM4, Q16487, Q68DZ2, Q7M4N8, Q9UQK7

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

Disease

DeafnessDisease variantNon-syndromic deafnessWaardenburg syndrome

PTM

Disulfide bondGlycoprotein

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
CSB-YP012376MO1-01	Recombinant Mouse Kit ligand (Kitlg), partial
CSB-EP012376BO-01	Recombinant Bovine Kit ligand (KITLG), partial
CSB-AP002061HU-01	Recombinant Human Kit ligand protein (KITLG), partial (Active)
CSB-MP012376MO1d9-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
CSB-MP012376MO1-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
CSB-AP004071MO-01	Recombinant Mouse Kit ligand (Kitlg), partial (Active)
CSB-AP003151MO-01	Recombinant Mouse Kit ligand protein (Kitlg), partial (Active)
CSB-EP004937HU1a0-01	Recombinant Human CD40 ligand (CD40LG), partial
CSB-EP004937HU4-01	Recombinant Human CD40 ligand (CD40LG), partial
CSB-RP060054h-01	Recombinant Human CD40 ligand (CD40LG), partial

Alternative Products

Catalog	Name
MBS7114985-01	Recombinant Human Kit Ligand (KITLG), Partial
AP70472-01	Recombinant Human Kit ligand(KITLG), partial
MBS9021264-01	Recombinant Human Kit ligand (KITLG), partial (Active)
MBS1381870-01	Recombinant Goat Kit ligand (KITLG), partial
MBS1348682-01	Recombinant Pig Kit ligand (KITLG), partial
MBS7111953	Recombinant Cat Kit ligand (KITLG), partial
MBS1376985-01	Recombinant Horse Kit ligand (KITLG), partial
MBS1355066-01	Recombinant Chicken Kit ligand (KITLG), partial
MBS7111955	Recombinant Rat Kit ligand (Kitlg), partial
MBS7111954	Recombinant Mouse Kit ligand (Kitlg), partial