Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active)

CAT:
399-CSB-AP003781HU-01
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active) - image 1

Recombinant Human Brain-derived neurotrophic factor (BDNF) (Active)

  • Product Name Alternative:

    Brain-Derived Neurotrophic Factor; BDNF; Abrineurin
  • Abbreviation:

    Recombinant Human BDNF protein (Active)
  • Gene Name:

    BDNF
  • UniProt:

    P23560
  • Expression Region:

    129-247aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
  • Tag:

    Tag-Free
  • Type:

    Active Protein & In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Neuroscience
  • Relevance:

    Brain-Derived Neurotrophic Factor (BDNF) is a member of the neurotrophin family. Along with other structurally related neurotrophic factors NGF, NT-3 and NT-4, BDNF binds with high affinity to the TrkB kinase receptor. It also binds with the LNGFR (for low-affinity nerve growth factor receptor, also known as p75) . BDNF promotes the survival, growth and differentiation of neurons. It serves as a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. BDNF expression is altered in neurodegenerative disorders such as Parkinson's and Alzheimer's disease.
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human TrkB (C-6His) at 5 μg/mL can bind Human BDNF, Biotinylated by NHS-biotin prior to testing, the EC50 of Human BDNF is ≤20 ng/mL.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
  • Molecular Weight:

    13 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein