Products for Research Use Only

GIP, Human (HEK293, hFc, solution)

CAT: 0804-HY-P74125-01Size: 5 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P74125-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
UNSPSC Description
The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc, solution) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag. The total length of GIP Protein, Human (HEK293, hFc, solution) is 72 a.a., with molecular weight of ~38.77 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gip-protein-human-hek293-fc.html
Purity
95.10
Smiles
EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Molecular Weight
Approximately 38.77 kDa
Shipping Conditions
Dry Ice
Storage Conditions
Stored at -80°C for 1 year