Products for Research Use Only
RegisterLogin

EGF, Human (HEK293, N-hFc, solution)

CAT: 0804-HY-P72982-01Size: 2 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72982-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The Progranulin/PGRN protein is involved in a variety of cellular processes, including cell growth, inflammation, and neurodegeneration. It acts as a regulator of tissue repair and has been implicated in the pathogenesis of several diseases, including Alzheimer's disease and frontotemporal dementia. Progranulin/PGRN interacts with various receptors and signaling pathways to exert its effects on cellular function and disease progression. EGF Protein, Human (HEK293, N-hFc, solution) is the recombinant human-derived EGF protein, expressed by HEK293 , with N-hFc labeled tag.
Product Name Alternative
EGF Protein, Human (HEK293, N-hFc, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/egf-protein-human-hek293-fc.html
Purity
95.80
Smiles
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Molecular Formula
1950 (Gene_ID) NP_001954.2 (N971-R1023) (Accession)
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P72982A-01EGF, Human (HEK293, N-hFc)
HY-P7442-01ACE2, Human (HEK293, hFc, solution)
HY-P74125-01GIP, Human (HEK293, hFc, solution)
HY-P76219-01CD299, Human (HEK293, hFc, solution)
HY-P77336-01CLEC4E, Rhesus Macaque (HEK293, hFc, solution)
HY-P76363A-01Gliomedin, Human (HEK293, N-hFc)
HY-P77395A-01IGFL2, Human (HEK293, N-hFc)
HY-P70453D-01Wnt3a Surrogate, Human (HEK293, N-hFc)
HY-P703745-01N-Cadherin, Human (565a.a, HEK293, hFc)
HY-P75942ANNT1/CLC, Human (HEK293, N-hFc)

Alternative Products

CatalogName
bs-47568P-01Recombinant human CD70 Protein, N-hFC & N-His (HEK293)
bs-47556P-01Recombinant human ADM Protein, N-hFC & N-His (HEK293)
bs-47309P-01Recombinant human VEGFB Protein, N-hFC & N-His (HEK293)
GTR19035681-01Recombinant human TNFSF13B protein, N-hFc-Flag (HEK293)
bs-47084P-01Recombinant human CD26 / DPP4 Protein, N-hFc (HEK293)
GTR19063846-01Recombinant human IL5 Protein, N-hFc & C-His (HEK293)
GTR19063436-01Recombinant human PDGFC Protein, N-hFc & C-His (HEK293)
GTR19063406-01Recombinant human IFNW1 Protein, N-hFc & C-His (HEK293)
GTR19063281-01Recombinant human IL25 Protein, N-hFc & C-His (HEK293)
GTR19063438-01Recombinant human ARTN Protein, N-hFc & C-His (HEK293)

Popular Products