β-CGRP, human (TFA)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


β-CGRP, human (TFA)
Description:
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells[1].Product Name Alternative:
Human β-CGRP (TFA) ; CGRP-II (Human) (TFA)UNSPSC:
12352209Target:
CGRP ReceptorType:
PeptidesRelated Pathways:
GPCR/G Protein; Neuronal SignalingApplications:
COVID-19-immunoregulationField of Research:
Inflammation/Immunology; Cardiovascular DiseaseAssay Protocol:
https://www.medchemexpress.com/_beta_-CGRP,_human_TFA.htmlPurity:
99.57Solubility:
H2O : 100 mg/mL (ultrasonic)Smiles:
[ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfidebridge:Cys2-Cys7)(TFAsalt)]Molecular Formula:
C162H267N51O48S3.xC2HF3O2Molecular Weight:
3793.41 (free base)References & Citations:
[1]McLatchie LM, et al. RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature. 1998 May 28;393 (6683) :333-9.|[2]Russell FA, et al. Calcitonin gene-related peptide: physiology and pathophysiology. Physiol Rev. 2014 Oct;94 (4) :1099-142.Shipping Conditions:
Blue IceStorage Conditions:
-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)Scientific Category:
PeptidesClinical Information:
No Development Reported
