Complement C3a, Human

CAT:
804-HY-P7862-03
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Complement C3a, Human - image 1

Complement C3a, Human

  • Description :

    Complement C3/C3a protein plays a key role in initiating the complement system through processing by C3 convertase in both the classical and alternative pathways. Complement C3/C3a protein is involved in various immune and inflammatory responses and also has a role in regulating blood pressure. Complement C3a Protein, Human is a recombinant Complement C3/C3a protein expressed in E. coli, no tag.[1][2][3][4][5][6][7][8][9][10][11].
  • Product Name Alternative :

    Complement C3a Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/complement-c3-c3a-protein-human.html
  • Purity :

    98.0
  • Smiles :

    SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR
  • Molecular Formula :

    718 (Gene_ID) P01024 (S672-R748) (Accession)
  • Molecular Weight :

    Approximately 9-13 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations :

    [1]Coulthard LG, et al. Is the complement activation product C3a a proinflammatory molecule? Re-evaluating the evidence and the myth. J Immunol. 2015 Apr 15;194 (8) :3542-8.|[2]Markiewski MM, et al. Complement and coagulation: strangers or partners in crime? Trends Immunol. 2007 Apr;28 (4) :184-92. |[3]Wu F, et al. Complement component C3a plays a critical role in endothelial activation and leukocyte recruitment into the brain. J Neuroinflammation. 2016 Jan 28;13:23.|[4]Kubota Y. 1992. The effect of human anaphylatoxins and neutrophils on histamine release from isolated human skin mast cells. J. Dermatol. 19: 19–26.|[5]Asgari E., et al. 2013. C3a modulates IL-1β secretion in human monocytes by regulating ATP efflux and subsequent NLRP3 inflammasome activation. Blood 122: 3473–3481.|[6]Daffern P. J., et al. 1995. C3a is a chemotaxin for human eosinophils but not for neutrophils. I. C3a stimulation of neutrophils is secondary to eosinophil activation. J. Exp. Med. 181: 2119–2127.|[7]Ringler E, et al. Complement protein C3a enhances adaptive immune responses towards FVIII products. Haematologica. 2023 Jun 1;108 (6) :1579-1589.|[8]Pei Y, et al. Complement component 3 protects human bronchial epithelial cells from cigarette smoke-induced oxidative stress and prevents incessant apoptosis. Front Immunol. 2022 Dec 20;13:1035930.|[9]Gao S, et al. Complement C3a and C3a Receptor Activation Mediates Podocyte Injuries in the Mechanism of Primary Membranous Nephropathy. J Am Soc Nephrol. 2022 Sep;33 (9) :1742-1756.|[10]Lillegard KE, et al. Differential effects of complement activation products c3a and c5a on cardiovascular function in hypertensive pregnant rats. J Pharmacol Exp Ther. 2014 Nov;351 (2) :344-51.|[11]Wu F, et al. Complement component C3a plays a critical role in endothelial activation and leukocyte recruitment into the brain. J Neuroinflammation. 2016 Jan 28;13:23.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide