IL-18, Rat

• Description :

  IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN) -γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

• Product Name Alternative :

  IL-18 Protein, Rat, Rat, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-18-protein-rat.html

• Purity :

  95.00

• Smiles :

  HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

• Molecular Formula :

  29197 (Gene_ID) P97636-1 (H37-S194) (Accession)

• Molecular Weight :

  Approximately 18.4 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Ye XJ, et al. The effects of interleukin-18 on rat articular chondrocytes: a study of mRNA expression and protein synthesis of proinflammatory substances. Clin Exp Immunol. 2007 Sep;149 (3) :553-60.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins