Recombinant Human Complement Component C3a/C3a

• Description :

  Source: E.coli. MW :9.1kD. Recombinant Human Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser672-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.

• Gene Name :

  C3

• Gene ID :

  718

• UniProt :

  P01024

• Components :

  Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

• Shipping Conditions :

  The product is shipped on dry ice/ice packs.

• Storage Conditions :

  Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

• Applications Notes :

  Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

• Amino Acids :

  SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR