Products for Research Use Only
RegisterLogin

Recombinant Mouse Complement Factor D/Adipsin (C-10His)

CAT: 0793-32-8767-10Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8767-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: Human Cells. MW :26.8kD. Recombinant Mouse Complement factor D is produced by our Mammalian expression system and the target gene encoding Ile26-Ser259 is expressed with a 10His tag at the C-terminus. Complement factor D, also known as adipsin, is a member of the chymotrypsin family of serine proteases, which plays an essential role in host defense as the rate-limiting enzyme in the alternative pathway of complement activation. Complement factor D activates a convertase (C3bBb) responsible for cleavage of the complement protein C3, which leads to the activation of terminal complement component C5-9 to form the membrane attack complex on microbial or cellular surfaces. It also functions in the regulation of systemic energy balance and physiologic and pathologic processes, including immunity and inflammation.
Gene Name
Cfd
Gene ID
11537
UniProt
P03953
Components
Lyophilized from a 0.2 μm filtered solution of 20mMTris,150mMNaCl, pH7.5.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTSHHHHHHHHHH

Related Products

CatalogName
32-8791-50Recombinant Human Complement Factor D/Adipsin (C-10His)
32-8791-10Recombinant Human Complement Factor D/Adipsin (C-10His)
32-11078-10Recombinant Mouse LEPR (C-10His)
32-8966-50Recombinant Mouse Renin (C-10His)
32-8966-10Recombinant Mouse Renin (C-10His)
32-11078-50Recombinant Mouse LEPR (C-10His)
32-8965-50Recombinant Human Renin (C-10His)
32-11040-50Recombinant Human TSLP (C-10His)
32-8965-10Recombinant Human Renin (C-10His)
32-11040-10Recombinant Human TSLP (C-10His)

Alternative Products

CatalogName
CP27-1mgRecombinant Human Complement Factor D/Adipsin (C-10His)
CP03-50ugRecombinant Mouse Complement Factor D/Adipsin (C-10His)
101-M278Complement Factor D (Adipsin)
477870CFD (Complement Factor D, Complement Factor D (Adipsin) )
abx121009-01Complement Factor D (Adipsin) Antibody
C7850-70C-01Complement Factor D (Adipsin, CFD)
abx617300Complement Factor D (Adipsin) Peptide
abx693319-01Human Complement Factor D (Adipsin) Protein
MBS3800788-01Human Complement Factor D/Adipsin, CFD (Adipsin) ELISA Kit
HY-P7861-01Complement Factor D/Adipsin, Human (HEK293, His)

Popular Products