Products for Research Use Only

Recombinant Mouse GM-CSF/CSF2

CAT: 0793-32-8572-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8572-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E.coli. MW :14.2kD. Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Ala18-Lys141 is expressed. Granulocyte-macrophage colony-stimulating factor is an enzyme that in mouse is encoded by the Csf2 gene, belongs to the GM-CSF family.CSF2 is a Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes
Gene Name
Csf2
Gene ID
12981
UniProt
P01587
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK