Recombinant Human Profilin-2/PFN2

CAT: 0793-32-8268-50Size: 50 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0793-32-8268-50Size:50 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

Source: E. coli. MW :15kD. Recombinant Human Profilin-2 is produced by our E.coli expression system and the target gene encoding Met1-Phe140 is expressed. Profilin-II (PFN2) is ubiquitous protein which belongs to the profilin family. PFN2 binds to actin, thenaffects the structure of the cytoskeleton. At high concentrations, profiling prevents the polymerization of actin, while increases that at low concentrations. PFN2 is a ubiquitous actin monomer-binding protein. It regulates actin polymerization in response to extra cellular signals. PFN2 binds to PIP2; it inhibits the formation of IP3 and DG.

Gene Name

PFN2

Gene ID

5217

UniProt

P35080

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

UniProtKB · P35080

Profilin-2

PROF2_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P35080
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: PFN2
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: —
Secondary accessions: B2R4C8, D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

PTM

Acetylation

Molecular function

Actin-binding

Coding sequence diversity

Alternative splicing

Cellular component

CytoplasmCytoskeleton

Related Products

Catalog	Name
32-4442-10	Recombinant Human Profilin-2
32-4441-50	Recombinant Human Profilin-1
32-4443-25	Recombinant Human Profilin-4
32-5193-20	Recombinant Human Uroplakin 2
32-4996-10	Recombinant Human Syntaxin-2
32-4663-25	Recombinant Human Relaxin-2
32-4627-10	Recombinant Human Reticulocalbin 2
32-4352-100	Recombinant Human Nucleobindin-2
32-4339-10	Recombinant Human Nucleophosmin 2
32-10353-500	Recombinant Human NHERF-2

Alternative Products

Catalog	Name
156453-01	Profilin 2 (PFN2) Recombinant, Human
AP75888-01	Recombinant Human Profilin-2/PFN2
RPU43423-01	Recombinant Human Profilin 2 (PFN2)
MBS636484-01	Profilin 2a (PFN2, Profilin-2) Recombinant, Human
MBS717567-01	Recombinant Human Profilin-2 (PFN2)
PT_41742-01	Profilin-2 Human Recombinant (PFN2 Human)
P9005-90	Profilin 2a (PFN2, Profilin-2) Recombinant, Human discontinued
BLT-02227P-01	Human PFN2 (Profilin-2) - Recombinant Protein
ARP4610-01	Recombinant Human Profilin-2/PFN2 Protein
ATGP0535-250	Recombinant human Profilin 2/PFN2 protein