Products for Research Use Only

Recombinant Human Syntaxin-8/STX8

CAT: 0793-32-8256-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8256-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E. coli. MW :24.6kD. Recombinant Human Syntaxin-8 is produced by our E.coli expression system and the target gene encoding Met1-Gly215 is expressed. Syntaxin-8 is a single-pass type IV membrane protein which belongs to the syntaxin family. It contains one t-SNARE coil homology domain. STX8 is highly expressed in heart, also found in brain, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas. STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis. It as a vesicle trafficking protein functions in the early secretory pathway, possibly mediating retrograde transport form cis-golgi membrane to the ER.
Gene Name
STX8
Gene ID
9482
UniProt
Q9UNK0
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG