Recombinant Mouse M-CSF/CSF1

CAT: 0793-32-7820-10Size: 10 µgDry Ice: NoHazardous: No
CAT#:0793-32-7820-10Size:10 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Source: Human Cells. MW :26kD. Recombinant Mouse Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Lys33-Glu262 is expressed. Macrophage colony-stimulating factor 1 (M-csf) is a single-pass type I membrane protein . It is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF affects macrophages and monocytes in several ways, including stimulating increased phagocytic and chemotactic activity, and increased tumour cell cytotoxicity. The role of M-CSF is not only restricted to the monocyte/macrophage cell lineage. By interacting with its membrane receptor, M-CSF also modulates the proliferation of earlier hematopoietic progenitors and influence numerous physiological processes involved in immunology, metabolism, fertility and pregnancy.
Gene Name
Csf1
Gene ID
12977
UniProt
P07141
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLEVDHHHHHH

Related Products

CatalogName
32-7424-50Recombinant Rat M-CSF/CSF1
32-7424-10Recombinant Rat M-CSF/CSF1
32-7374-10Recombinant Human M-CSF/CSF1 (C-6His)
32-7374-50Recombinant Human M-CSF/CSF1 (C-6His)
32-8572-50Recombinant Mouse GM-CSF/CSF2
32-8572-10Recombinant Mouse GM-CSF/CSF2
32-7831-50Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1 (C-6His)
32-7831-10Recombinant Mouse Granulocyte Colony-Stimulating Factor/G-CSF/CSF1 (C-6His)
32-1590-10M CSF Recombinant Protein
32-1593-25M CSF His Recombinant Protein

Alternative Products

CatalogName
CB34-500ugRecombinant Mouse M-CSF/CSF1
PPT-16471Mouse CSF1/M-CSF Recombinant Protein
MF-0132287-01M-CSF/CSF1 Protein, Mouse, Recombinant
PKSM041111-01Recombinant Mouse M-CSF/CSF1 Protein
E40MOP2225Recombinant Mouse M-Csf/Csf1 Protein, No Tag
C756-10ugRecombinant Mouse M-CSF/CSF1 (C-6His)
PM1019-.1Recombinant Mouse M-CSF/CSF1 (His, Flag)
MF-0107350-01M-CSF/CSF1 Protein, Mouse, Recombinant (CHO)
MF-0107860-01M-CSF/CSF1 Protein, Mouse, Recombinant (His)
AP93990Recombinant Mouse CSF1/M-CSF Protein, N-His

Popular Products