Products for Research Use Only
RegisterLogin

Recombinant Human Ciliary Neurotrophic Factor/CNTF

CAT: 0793-32-7083-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-7083-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E.coli. MW :22.93kD. Recombinant Human CNTF is produced by our E.coli expression system and the target gene encoding Ala2-Met200 is expressed. Ciliary Neurotrophic Factor (CNTF) is a potent survival factor for neurons and oligodendrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal transducing subunit in their receptor complexes. CNTF, like FGF acidic, FGF basic, and PD-ECGF (platelet-derived endothelial cell growth factor), does not possess a signal sequence that would allow secretion of the factor by classical secretion pathways. The mechanism underlying the release of CNTF is unknown.
Gene Name
CNTF
Gene ID
1270
UniProt
P26441
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Related Products

CatalogName
32-7065-10Recombinant Human Brain-Derived Neurotrophic Factor/BDNF
32-7065-50Recombinant Human Brain-Derived Neurotrophic Factor/BDNF
32-18095-50Recombinant Human CNTF Protein
32-1110-20CNTF Recombinant Protein
32-7066-10Recombinant Human Pro-Brain-Derived Neurotrophic Factor/pro-BDNF
32-7204-10Recombinant Human Glial Cell Line-Derived Neurotrophic Factor/GDNF
32-7204-50Recombinant Human Glial Cell Line-Derived Neurotrophic Factor/GDNF
32-7066-50Recombinant Human Pro-Brain-Derived Neurotrophic Factor/pro-BDNF
32-1111-20CNTF His Recombinant Protein
32-9651-500Recombinant Human Cerebral Dopamine Neurotrophic Factor/CDNF/ARMETL1 (C-6His)

Alternative Products

CatalogName
310943-01CNTF (Ciliary Neurotrophic Factor)
C5073-07Ciliary Neurotrophic Factor (CNTF)
MBS8532865-01CNTF/Ciliary neurotrophic factor
RC218-19Ciliary Neurotrophic Factor, CNTF, human
C5073-07-PECiliary Neurotrophic Factor (CNTF) (PE)
C5073-07-FITCCiliary Neurotrophic Factor (CNTF) (FITC)
C5073-07-APCCiliary Neurotrophic Factor (CNTF) (APC)
C5073-09D-01Ciliary Neurotrophic Factor (CNTF) discontinued
C5073-05JCNTF (HCNTF, Ciliary Neurotrophic Factor)
244813CNTF (Ciliary Neurotrophic Factor HCNTF)

Popular Products