Recombinant Human Interleukin-1a/IL-1a

CAT: 0793-32-7059-10Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0793-32-7059-10Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

Source: E.coli. MW :18kD. Recombinant Human Interleukin-1 alpha is produced by our E.coli expression system and the target gene encoding Ser113-Ala271 is expressed. Interleukin-1 alpha (IL1a) is a cytokine member of the interleukin-1 family. IL-1 consists of two distinct forms: IL1a and IL1 beta that recognize the same cell surface receptors but are distinct proteins with approximately 25% amino acid sequence identity. IL1a is constitutively produced by epithelial cells and plays an essential role in maintenance of skin barrier function. Upon stimulation, a wide variety of cells including osteoblasts, monocytes, macrophages can be induced to express IL1a. IL1a possesses a wide range of metabolic, physiological, haematopoietic activities, and is critically involved in the regulation of the immune responses and inflammatory responses.

Gene Name

IL1A

Gene ID

3552

UniProt

P01583

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

UniProtKB · P01583

Interleukin-1 alpha

IL1A_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P01583
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: IL1A
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: IL-1 alpha
EC number: —
Processing: Precursor
Secondary accessions: Q53QF9, Q7RU02

Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

PTM

AcetylationGlycoproteinLipoproteinMyristatePhosphoprotein

Molecular function

CytokineMitogenPyrogen

Cellular component

CytoplasmNucleusSecreted

Biological process

Inflammatory response

Related Products

Catalog	Name
32-7034-10	Recombinant Mouse Interleukin-1a/IL-1a
32-7034-50	Recombinant Mouse Interleukin-1a/IL-1a
32-8190-10	Recombinant Rat Interleukin-1 Alpha/ IL-1a
32-8190-50	Recombinant Rat Interleukin-1 Alpha/ IL-1a
32-11461-20	Biotinylated Human IL-1a (C-Avi)
32-11461-100	Biotinylated Human IL-1a (C-Avi)
32-4995-25	Recombinant Human Syntaxin-1A
32-11270-50	Recombinant Human Interleukin-18/IL-18/IL-1F4
32-11270-10	Recombinant Human Interleukin-18/IL-18/IL-1F4
32-7063-10	Recombinant Human Interleukin-38/IL-38/IL-1F10

Alternative Products

Catalog	Name
MBS9419954-01	Recombinant Human Interleukin-1 a (rHu IL-1a)
PEH0888-01	Recombinant Human IL-1a
BRP1190-1	Recombinant Human IL-1a Protein
MBS2557076-01	Recombinant Human IL-1A/IL-1alpha Protein
PKSH033458-01	Recombinant Human IL-1A/IL-1α Protein
GTR19125851-01	Recombinant Human IL-1a Protein (Biotin)
C13C-01	Recombinant Human IL-1a (C-Fc)
GR119221	Genorise® Recombinant Human IL-1A protein
TMPY-00854-01	IL-1 alpha/IL-1A Protein, Human, Recombinant
TMPJ-00162-01	IL-1 alpha/IL-1A Protein, Human, Recombinant (hFc)